PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2DL_C4C47B5B8.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 221aa    MW: 25173.2 Da    PI: 9.939
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2DL_C4C47B5B8.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.12.2e-0916681163
                           HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1 11 qkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                           + NR +A rs +RK  +i+eLe+kv+ L++e ++L  +l+ l+   + l++e+
  Traes_2DL_C4C47B5B8.2 16 MANRQSAARSKERKMRYIAELERKVQCLQTEATTLSAQLSLLQRDTSGLTNEN 68
                           56****************************************99988888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.6E-10770IPR004827Basic-leucine zipper domain
CDDcd147033.87E-181560No hitNo description
SuperFamilySSF579591.13E-91561No hitNo description
Gene3DG3DSA:1.20.5.1702.8E-101665No hitNo description
PfamPF001701.3E-71667IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.1511871IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MPHESREFHH CNLVIMANRQ SAARSKERKM RYIAELERKV QCLQTEATTL SAQLSLLQRD  60
TSGLTNENGD LKLQVQTMEQ QVRLQDALND RLRDEVQQLK IATGQLNANN GNLGNFGGLS  120
SYGVNPQSYQ RSQMQQQSLL AAQQLQQLQI HSQHQQPQMH MQQQRLASVR QQQQQQQQQQ  180
QQSQLRPEAL PFPGDLKMKG IAMTAHVQNA GPFDGRARSE P
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3668880.0AK366888.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2047M20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003580055.11e-79PREDICTED: transcription factor RF2a-like
SwissprotQ040885e-48POF21_ARATH; Probable transcription factor PosF21
TrEMBLW5C0041e-158W5C004_WHEAT; Uncharacterized protein
STRINGMLOC_64362.11e-82(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123022937
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.12e-41bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]